Sponsored Links
1.67 Rating by ClearWebStats

gisprojects.net has registered 1 decade 1 year ago. This website has a #961,648 rank in global traffic. It has a .net as an domain extension. This domain is estimated value of $ 720.00 and has a daily earning of $ 3.00. Additionally, the website is monetizing using Adsense. While no active threats were reported recently by users, gisprojects.net is SAFE to browse.

Get Custom Widget

Traffic Report for gisprojects.net

Daily Unique Visitors: 500
Daily Pageviews: 1,000

Estimated Valuation

Income Per Day: $ 3.00
Estimated Worth: $ 720.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 961,648
Domain Authority: Not Applicable
DMOZ Listing: No
Google Pagerank
PR 0 out of 10
PageSpeed Score
Siteadvisor Rating
Not Applicable

Where is gisprojects.net server located?

Hosted IP Address:

Hosted Country:

United States US

Location Latitude:


Location Longitude:

gisprojects.net search engine traffic

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Page Resources Breakdown

Homepage Links Analysis

GisProjects.net – Home Decors Gallery

Website Inpage Analysis

H1 Headings: 8 H2 Headings: 8
H3 Headings: 12 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 12
Google Adsense: pub-4874461946375134 Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e.

Ebooks For Easy Life – Ebooks For Easy Life

- ebooksforeasylife.com

  Not Applicable   $ 8.95

Cinema World Movies

- cinemaworldmovies.com

cinemaworldmovies.com is providing you free access to all the latest movies for free. You can get every movie here for free.

  409,402   $ 5,760.00

Home and Kitchen Appliances Review

- homeandkitchenappliancesreview.com

Ultimate Guide to Buy Home and Kitchen Appliances - Reviews and Comparison

  Not Applicable   $ 8.95

Casarão Mondo - Sua Fonte De Informações Sobre Utensilios Domésticos

- casaraomondo.com

Sua Fonte De Informações Sobre Utensilios Domésticos

  Not Applicable   $ 8.95

Mega Streaming – Streaming Movie Full HD Free

- mega-streaming.com

  Not Applicable   $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
X-Powered-By: PHP/5.5.38
Content-Type: text/html; charset=UTF-8
Vary: Accept-Encoding, Cookie
Cache-Control: max-age=3, must-revalidate
WP-Super-Cache: Served supercache file from PHP
Content-Length: 9139
Content-Encoding: gzip
Date: Wed, 09 Nov 2016 11:24:20 GMT
Accept-Ranges: bytes
Server: LiteSpeed
Connection: close

Domain Information for gisprojects.net

Domain Registrar: GODADDY.COM, LLC
Registration Date: 2005-12-15 1 decade 1 year 10 months ago
Last Modified: 2016-04-29 1 year 5 months 3 weeks ago
Expiration Date: 2016-12-15 10 months 4 days 9 hours ago

Domain Nameserver Information

Host IP Address Country
ns13.hawkhost.com Canada Canada
ns14.hawkhost.com Canada Canada

DNS Record Analysis

Host Type TTL Extra
gisprojects.net A 86400 IP:
gisprojects.net NS 86400 Target: ns14.hawkhost.com
gisprojects.net NS 86400 Target: ns13.hawkhost.com
gisprojects.net SOA 86400 MNAME: ns13.hawkhost.com
RNAME: server.hawkhost.com
Serial: 2016081522
Refresh: 86400
Retry: 7200
Expire: 2419200
gisprojects.net MX 86400 Target: gisprojects.net
gisprojects.net TXT 86400 TXT: v=spf1 +a +mx +ip4:
+include:_spf.arandomserver.com ~all

Similarly Ranked Websites to gisprojects.net

Кира-скрап - клипарт и рамки на прозрачном фоне

- kira-scrap.ru

Рамки и картинки в PNG для оформления фотографий, сайтов, для создания творческих работ в фотошопе

  961,649   $ 720.00

Home main | Constant Buy

- constantbuy.com

  961,650   $ 720.00

Tri Viet Securities

- tvsc.vn

  961,653   $ 720.00


- chinway.com.cn

  961,653   $ 720.00

San Diego Adventure Riders - Dualsport around San Diego

- dualsport-sd.com

  961,654   $ 720.00

Competitive search data from SEMrush

gisprojects.net search engine traffic graph

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup for gisprojects.net

Domain Name: gisprojects.net
Registrar URL:
Registrant Name: Monique
Registrant Organization:
Name Server:
Name Server: NS14.HAWKHOST.COM

For complete domain details go
The data contained in GoDaddy.com, LLC's WhoIs
while believed by the company to be reliable, is
provided "as is"
with no guarantee or warranties regarding its
accuracy. This
information is provided for the sole purpose of
assisting you
in obtaining information about domain name
registration records.
Any use of this data for any other purpose
is expressly forbidden without the prior written
permission of
GoDaddy.com, LLC. By submitting an inquiry,
you agree to these
terms of usage and limitations of warranty. In particular,
agree not to use this data to allow, enable, or otherwise make
dissemination or collection of this data, in part or in
its entirety, for any
purpose, such as the transmission of
unsolicited advertising and
and solicitations of any kind,
including spam. You further agree
not to use this data to enable
high volume, automated or robotic electronic
processes designed to
collect or compile this data for any purpose,
including mining
this data for your own personal or commercial

Please note: the registrant of the domain name is
in the "registrant" section. In most cases, GoDaddy.com,
is not the registrant of domain names listed in this database.

Like gisprojects.net ? Comment / rate / feedback below